PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_53.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 191aa    MW: 21855.4 Da    PI: 7.0092
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_53.3genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.21.1e-1575124554
                                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                                 +r+rr+++NRe+ArrsR RK++ ++eL   v  L +eN+ L+++l++ ++
  evm.model.supercontig_53.3  75 RRQRRMISNRESARRSRMRKQKHLDELWSQVVRLRNENHGLIDRLNHVSE 124
                                 79*****************************************9998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-1671135IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.57673124IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.95E-1375126No hitNo description
Gene3DG3DSA:1.20.5.1709.2E-1375148No hitNo description
PfamPF001703.3E-1375123IPR004827Basic-leucine zipper domain
CDDcd147021.90E-1876127No hitNo description
PROSITE patternPS0003607893IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MLQGEITEMN YCLQPENYPV QIPSSNNNHN LSMIQPALQF NSNLFGIPQS SSCLSSNNST  60
SDEAEEHQRS IIDERRQRRM ISNRESARRS RMRKQKHLDE LWSQVVRLRN ENHGLIDRLN  120
HVSECHHRVV QENAKLKEEA ADLRRMLTDL QISSPYTAVL RAGLDDQITC NTAHLRAEST  180
ISNASIDLLH *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18794RRSRMRKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007045693.15e-71Basic leucine-zipper 42
SwissprotQ9FMC22e-40BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A061E9475e-71A0A061E947_THECC; Basic leucine-zipper 42
STRINGVIT_01s0010g00930.t013e-65(Vitis vinifera)
STRINGPOPTR_0008s11260.13e-65(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31122667
Representative plantOGRP31041129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.12e-43basic leucine-zipper 42